IGF-1 LR3 10mg

$55.00

Product Highlights

  • CAS #: Supplier/COA verification required
  • Compound type: Synthetic recombinant protein
  • Amino acid length: 83 amino acids
  • Amino acid sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Molecular formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
  • Appearance: Light Yellow to White Lyophilized Powder
  • Molecular weight: Approximately 9.1 kDa
  • Storage: Keep refrigerated after reconstitution.

For research use only

In stock

Bulk Order Discounts

Quanity Price
3 - 4 $52.25
5 - 7 $51.15
8 - 10 $49.50
11 - 20 $46.75

Product Description

IGF-1 LR3 is a synthetic recombinant protein analog, not a simple short peptide. It is an 83-amino-acid analog of human IGF-1 that includes an arginine substitution at position 3 and a 13-amino-acid N-terminal extension, and it is commonly supplied as a non-glycosylated lyophilized protein for laboratory use. Supplier references describe it as a defined research material used in cell signaling, receptor-pathway studies, and controlled formulation workflows.

Research interest in IGF-1 LR3 centers on its interaction with the IGF-1 receptor, its reduced affinity for insulin-like growth factor binding proteins (IGFBPs) relative to native IGF-1, and its use in cell-culture and growth-factor signaling models. Supplier and technical references position it in workflows involving cell proliferation assays, media supplementation, and recombinant protein evaluation, with one R&D Systems datasheet specifically reporting activity in an MCF-7 human breast cancer cell proliferation assay and noting that IGFBP-3 does not inhibit its activity under that test system.

ATTENTION: All Unique ChemX products featured here are intended exclusively for research and development purposes. They are not designed for any form of human or animal consumption. These products have not undergone evaluation by the U.S. Food and Drug Administration.

Your Cart

You are $200.00 away from free shipping.

Subtotal
$0.00
Shipping
Free!
Tax
$0.00
Total
$0.00